Lake Lane Fishing and Hunting Getaway
OVERVIEW
LAKELANEFISHINGANDCAMPINGGETAWAY.COM TRAFFIC
Date Range
Date Range
Date Range
LAKELANEFISHINGANDCAMPINGGETAWAY.COM HISTORY
PERIOD
LINKS TO DOMAIN
WHAT DOES LAKELANEFISHINGANDCAMPINGGETAWAY.COM LOOK LIKE?
CONTACTS
Lake Lane Getaway
Hannah Maurer
1339 Windfall Road
Olean, New York, 14760
United States
LAKELANEFISHINGANDCAMPINGGETAWAY.COM SERVER
NAME SERVERS
BROWSER IMAGE
SERVER OS
We observed that this domain is using the nginx/1.12.2 os.HTML TITLE
Lake Lane Fishing and Hunting GetawayDESCRIPTION
Hunting getaway for big and small game. Fresh water pond fishing. - bait shop -pole rental -refreshments Reservations and major credit cards accepted.PARSED CONTENT
The domain lakelanefishingandcampinggetaway.com states the following, "Saturday, Sunday and Holidays." We analyzed that the webpage also stated " Major Credit Cards Accepted! Fresh Water Pond Fishing." It also stated " Bait shop - pole rental - refreshments. Olean New York 716 373 2080. Bring your military ID and receive 2 hours of. Free fishing on Sundays only. Welcome but pay regular rates. Family Fishing for a Day Special. 29 Up to 6 people. Welcome to Lake Lane Fishing and Camping Getaway." The header had Fishing Tournaments as the highest ranking search term. This keyword was followed by fishing lessons, custom furniture for sale, and picnic area which isn't as urgent as Fishing Tournaments. The other words they used was bait shop. birthday parties is also included but might not be understood by search parsers.ANALYZE OTHER WEB SITES
Outdoor Sports Show combined with Fishing Tournaments, June 2 and 3, 2012, Olean, NY. Sanctioned Turkey Calling Contest that weekend at Lake Lane also.
Boating at Margaritaville at Lanier Islands. Locations of USACE Fee Machines on Lake Lanier.
Ready to jump in? Lake Lanier provides water, recreation, economic value, scenic beauty, and more. Become part of LLA and help us make it sustainable for the next 100 years. Come visit our booth at the. Atlanta Boat Show this weekend! We are excited to share information about Lake Lanier with visitors from all over. Come sign up for membership and find out how to get involved! I WANT MORE INFO. Why is Lake Lanier still low when.
Latest Lake Lanier Real Estate Listings. 8485 Bullock Lane, Gainesville GA 30506. Bedrooms - 3 Bathrooms - 3 Subdivision - Ambra Cove. Beautiful remodel with open water views in central location on Lake Lanier! 8275 Bailey Mill Road, Gainesville GA, 30506. Bedrooms - 3 Bathrooms - 4 Subdivision - Driftwood. Have a question you need answered? Check out our FAQ page for the answers to all your most common questions! There is a lot to .
Friday, August 20, 2010. Lake Experts you need to Advertise Your specialty. If you are not advertising your Waterfront or Lakefront Specialty here, then you are losing BIG money! Capitalize on your Waterfront or Lakefront Speciality. You have to spend money to make money and not having an advertising plan is just plain bad business. We were even interviewed by THE WEATHER CHANNEL when we went through. If you have any kind of business involving any Lake in the USA, you need to .